1. Notes: 98 / 2 years ago  from veer (originally from papiersgras)
    veer:

(via papiersgras)
     
  2. Notes

    1. xax-c reblogged this from hobbypics
    2. spaulings reblogged this from fetish4
    3. lustyla reblogged this from fetish4
    4. scienceisfake reblogged this from fetish4
    5. naiveandcarefree reblogged this from dubaihigh
    6. dubaihigh reblogged this from fetish4
    7. fetish4 reblogged this from hobbypics
    8. hobbypics reblogged this from 26hundredmiles
    9. lan39 reblogged this from yesdaddy
    10. ornatrix reblogged this from kissmegentlyfuckmehard and added:
      just don’t stop..
    11. puddingandbeer reblogged this from sirssub2
    12. naughtynomics reblogged this from tarrinj
    13. tarrinj reblogged this from cindersk
    14. cindersk reblogged this from sirssub2
    15. sirssub2 reblogged this from raunchygirl and added:
      Nothing compares to the sounds of your pain. i know how much You love that sound Sir
    16. theheartcore reblogged this from fancymonochrome
    17. fancymonochrome reblogged this from 26hundredmiles
    18. evilgirl333x2 reblogged this from showmeyoursex
    19. showmeyoursex reblogged this from kissmegentlyfuckmehard
    20. angkot reblogged this from kissmegentlyfuckmehard and added:
      bikin bising tetangga, mengganggu lingkungan
    21. theblueearthgoddess reblogged this from kissmegentlyfuckmehard
    22. kissmegentlyfuckmehard reblogged this from raunchygirl
    23. gentlemanpervert reblogged this from 26hundredmiles
    24. 26hundredmiles reblogged this from sheslostcontrol-again and added:
      Here - before I get too sappy. Maybe all I really need right now is a good railing. sheslostcontrol-again:
    25. tecaisamused reblogged this from yesdaddy
    26. libraryvicious reblogged this from ematerial
    27. ematerial reblogged this from raunchygirl
    28. whydoyouask reblogged this from raunchygirl
avatar_128
 
 
"Beauty is in the eye of the beholder"

Disclaimer: All images, unless otherwise noted, were taken from the Internet and are assumed to be in the public domain.
 
 

Following

suicideblondepeixebananashesolove-to-love-younrknbohemeamisswallflowermelcxslickyforeversmuttynakednessthepulpgirlsforhereyesonlytheladycheekyaltpornpornotopiaconflictinghearthelenofdestroythrushboneenuffsaidgaliziaartpixiegordonpymfinenudeslookbookdotnuiloveasssexartandpoliticslikeneelyoharaschemeranddreamermonsieur831erotismolibraryvixenreirainouecargohoodawkmancurvycouturepdchagrinoubdsmsamplerhauntedhallwaysthingsthatexcitemeveerafuckadayhypersexualgirlcurves-n-lightsdirtyroseseaofsinsensualitieseroticanalittlemissbloodismyfavoritecolordeepdreamsstyleandsubstancecrazywithitcrazierwithoutplaceboaphroditiimageimagerunawaytrainbendmeoverfuckmelikethatdeadvodkafuckyeahprettygirlsnylonfoxiecarnalknowledgepiecessuckingbingo-bongoquotewhoreberenikestolzeeleashaforpervusemekennedythemainelacoliflorerogenousgottfrieddeepervalleynakedandnaturaltatiellewhipherslackeracidnudesthestylemovementourpornsideerotica-sevenwonderlandcode831wanderer-of-dark-dreamsplayhardfuckhardersouleroeroticgurusexasksexualassessexxxyxxxesjezebelinhell
 

Tumblr