1. Notes: 408 / 2 years ago  from enuffsaid (originally from bonjourmadame)
     
  2. Notes

    1. erotta reblogged this from milesoff
    2. cigarperfume reblogged this from d-e-s-t-r-o-y-e-r
    3. phroydianslip reblogged this from kinkygent
    4. kinkygent reblogged this from idnava
    5. taywebz reblogged this from garage-punks-hiro and added:
      I’m almost certain thats Mellisa Clarke…
    6. garage-punks-hiro reblogged this from lingeriebabes
    7. wadman812 reblogged this from voyeur761
    8. chiaroscuro-nude reblogged this from beautifulgirlfactory
    9. elitistagenda reblogged this from mechanocomplex
    10. mechanocomplex reblogged this from unparallelthoughts
    11. beautifulw00men reblogged this from faceexpressions
    12. freakyfunbistuff reblogged this from oowattanite
    13. searcher2cr-erotica reblogged this from holysballs
    14. sweet-tartz reblogged this from voyeur761
avatar_128
 
 
"Beauty is in the eye of the beholder"

Disclaimer: All images, unless otherwise noted, were taken from the Internet and are assumed to be in the public domain.
 
 

Following

theladycheekylookbookdotnuartpixiesuicideblondemisswallflowerbohemeashesomonsieur831melcaltpornconflictingheartgordonpymsamplerforhereyesonlythepulpgirlschagrinoudawkmanjeralyndwilefuckmelikethatbdsmsensualitiesfinenudespeixebananahypersexualgirldeadvodkafuckyeahprettygirlslikeneelyoharacargohooxslickyforevernylonfoxiehauntedhallwayssmuttynakednesscurves-n-lightsaphroditirunawaytrainsexartandpoliticspornotopiareirainouethrushbonegaliziadirtyrosecarnalknowledgeiloveasscrazywithitcrazierwithoutlove-to-love-youlibraryvixencurvycouturepiecespdimageimagebloodismyfavoritecolorhelenofdestroybendmeoversuckingnrkneroticanabingo-bongothingsthatexcitemeerotismoquotewhoreberenikeveerstolzeeleashaforpervusemestyleandsubstanceseaofsinafuckadayplacebodeepdreamsenuffsaidlittlemisskennedythemainelacoliflorerogenousgottfrieddeepervalleynakedandnaturaltatiellewhipherslackeracidnudesthestylemovementourpornsideerotica-sevenwonderlandcode831wanderer-of-dark-dreamsplayhardfuckhardersouleroeroticgurusexasksexualassessexxxyxxxesjezebelinhell
 

Tumblr